ac2 26 Search Results


94
Tocris peptide ac2 26
Peptide Ac2 26, supplied by Tocris, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc03288723-46-0-3?v=Tocris
Average 94 stars, based on 1 article reviews
peptide ac2 26 - by Bioz Stars, 2026-08
94/100 stars
  Buy from Supplier

sag  (Tocris)
93
Tocris sag
Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed <t>to</t> <t>recombinant</t> human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and <t>SAG</t> (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Sag, supplied by Tocris, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc13032639-139-16-17?v=Tocris
Average 93 stars, based on 1 article reviews
sag - by Bioz Stars, 2026-08
93/100 stars
  Buy from Supplier

90
BOC Sciences ac2 26
Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed <t>to</t> <t>recombinant</t> human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and <t>SAG</t> (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Ac2 26, supplied by BOC Sciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pm20079938-10-14-35?v=BOC+Sciences
Average 90 stars, based on 1 article reviews
ac2 26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Bankpeptide biological technology co LTD ac2-26 (ac-amvseflkqawfieneeqeyvqtvk
Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed <t>to</t> <t>recombinant</t> human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and <t>SAG</t> (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk, supplied by Bankpeptide biological technology co LTD, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/ppr0164584-54-2-7?v=Bankpeptide+biological+technology+co+LTD
Average 90 stars, based on 1 article reviews
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GlpBio Technology Inc ac2-26
Relative expression of target peptides in <t> cisplatin‐resistant/sensitive </t> serum of ovarian cancer.
Ac2 26, supplied by GlpBio Technology Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc11659116-61-0-7?v=GlpBio+Technology+Inc
Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Biopeptide peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk)
Relative expression of target peptides in <t> cisplatin‐resistant/sensitive </t> serum of ovarian cancer.
Peptides And Antibodies Murine Ac2 26 (Acetyl Amvseflkqarflenqeqeyvqavk), supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc03464519-45-9-19?v=Biopeptide
Average 90 stars, based on 1 article reviews
peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk) - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenScript corporation ac2 26
Relative expression of target peptides in <t> cisplatin‐resistant/sensitive </t> serum of ovarian cancer.
Ac2 26, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc07160667-192-2-8?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
ac2 26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Topscience Co Ltd ac2-26
Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + <t> Ac2-26, </t> HFD, and HFD + Ac2-26 groups
Ac2 26, supplied by Topscience Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc11662704-86-6-9?v=Topscience+Co+Ltd
Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
ChinaPeptides cy5-labeled ac2-26
Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + <t> Ac2-26, </t> HFD, and HFD + Ac2-26 groups
Cy5 Labeled Ac2 26, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc06755521__ADVS___6___1900610___s001-6-5-15?v=ChinaPeptides
Average 90 stars, based on 1 article reviews
cy5-labeled ac2-26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenicBio BioTech Co Ltd ac2-26
Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + <t> Ac2-26, </t> HFD, and HFD + Ac2-26 groups
Ac2 26, supplied by GenicBio BioTech Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/ppr0133238-51-27-34?v=GenicBio+BioTech+Co+Ltd
Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GL Biochem 1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk)
Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + <t> Ac2-26, </t> HFD, and HFD + Ac2-26 groups
1μm Annexin A1 N Terminal Derived Peptide Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk), supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/ppr0522296-65-21-24?v=GL+Biochem
Average 90 stars, based on 1 article reviews
1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Pepceuticals Ltd ac2-26 peptide
Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + <t> Ac2-26, </t> HFD, and HFD + Ac2-26 groups
Ac2 26 Peptide, supplied by Pepceuticals Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ac2+26/pmc09182642-73-10-16?v=Pepceuticals+Ltd
Average 90 stars, based on 1 article reviews
ac2-26 peptide - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

Image Search Results


Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed to recombinant human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test

Journal: Molecular Cancer

Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms

doi: 10.1186/s12943-026-02611-y

Figure Lengend Snippet: Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed to recombinant human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test

Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP), SAG (Tocris, Cat# 4366), vismodegib (Tocris, Cat# 7710), sonidegib (Tocris, Cat# 7826), GANT61 (Tocris, Cat# 3191), and itraconazole (Tocris, Cat# 5981).

Techniques: Derivative Assay, Activation Assay, Inhibition, Fluorescence, Staining, Recombinant, Expressing, Quantitative RT-PCR, Control, Labeling, Quantitation Assay, BrdU Incorporation Assay

HH signaling regulates the growth of GFAP ΔMen1 and Sox10 ΔMen1 pancreatic NET tumoroids. A Phase contrast and ( B ) fluorescence images of PanNET tumoroids from Sox10-Cre; Men1 FL/FL ; LSL-tdTomato mice. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure PanNET tumoroid growth in the presence of HH pathway agonists or ( D ) inhibitors of the canonical and ( E ) non-canonical HH signaling pathways. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates in two unique mouse PanNET tumoroid lines). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F BrdU incorporation was used to measure tumoroid proliferation in GFAP ΔMen1 and Sox10 ΔMen1 PanNET tumoroids after 72 h treatment. ( n = 4). ** = p < 0.01, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. G Relative fold-change in Chga mRNA levels in PanNET tumoroids following 72 h treatment. ( n = 5). H Western blot analysis of HH pathway proteins in PanNET tumoroids after 72 h treatment. I Quantitation of SHH protein expression normalized to beta-actin and DMSO vehicle control from the western blot analysis in panel ( H ). ( n = 3). J Western blot analysis and ( K ) associated quantitation of phosphorylated and total ERK and AKT growth pathways in PanNET tumoroids after 72 h treatment. ( n = 3). * = p < 0.05, ** = p < 0.01, *** = p < 0.001 by Kruskal-Wallis test

Journal: Molecular Cancer

Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms

doi: 10.1186/s12943-026-02611-y

Figure Lengend Snippet: HH signaling regulates the growth of GFAP ΔMen1 and Sox10 ΔMen1 pancreatic NET tumoroids. A Phase contrast and ( B ) fluorescence images of PanNET tumoroids from Sox10-Cre; Men1 FL/FL ; LSL-tdTomato mice. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure PanNET tumoroid growth in the presence of HH pathway agonists or ( D ) inhibitors of the canonical and ( E ) non-canonical HH signaling pathways. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates in two unique mouse PanNET tumoroid lines). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F BrdU incorporation was used to measure tumoroid proliferation in GFAP ΔMen1 and Sox10 ΔMen1 PanNET tumoroids after 72 h treatment. ( n = 4). ** = p < 0.01, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. G Relative fold-change in Chga mRNA levels in PanNET tumoroids following 72 h treatment. ( n = 5). H Western blot analysis of HH pathway proteins in PanNET tumoroids after 72 h treatment. I Quantitation of SHH protein expression normalized to beta-actin and DMSO vehicle control from the western blot analysis in panel ( H ). ( n = 3). J Western blot analysis and ( K ) associated quantitation of phosphorylated and total ERK and AKT growth pathways in PanNET tumoroids after 72 h treatment. ( n = 3). * = p < 0.05, ** = p < 0.01, *** = p < 0.001 by Kruskal-Wallis test

Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP), SAG (Tocris, Cat# 4366), vismodegib (Tocris, Cat# 7710), sonidegib (Tocris, Cat# 7826), GANT61 (Tocris, Cat# 3191), and itraconazole (Tocris, Cat# 5981).

Techniques: Fluorescence, Protein-Protein interactions, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Expressing

GFAP ΔMen1 DNETs and jejunal NETs are sensitive to HH pathway activation and inhibition. A Phase contrast and ( B ) fluorescence images of DNET tumoroids from a GFAP-Cre; Men1 FL/FL ; LSL-tdTomato mouse. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure DNET tumoroid growth in the presence of HH pathway inhibitors. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates using one mouse DNET tumoroid line). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. D Relative BrdU incorporation in a second GFAP ΔMen1 DNET tumoroid line and ( E ) a jejunal tumoroid line (J-NET) after 72 h treatment. ( n = 4). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F Western blot analysis of SHH, ERK, and AKT growth pathways in J-NET tumoroids after 72 h treatment. G Western blot quantitation of SHH and ( H ) phosphorylated and total ERK and AKT proteins normalized to GAPDH and DMSO vehicle control. ( n = 3). * = p < 0.05 by Kruskal-Wallis test. I Crystal violet staining of mouse STC-1 SI-NET cells after 48 h treatment with agonists and inhibitors of the HH signaling pathway. J BrdU incorporation in STC-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test

Journal: Molecular Cancer

Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms

doi: 10.1186/s12943-026-02611-y

Figure Lengend Snippet: GFAP ΔMen1 DNETs and jejunal NETs are sensitive to HH pathway activation and inhibition. A Phase contrast and ( B ) fluorescence images of DNET tumoroids from a GFAP-Cre; Men1 FL/FL ; LSL-tdTomato mouse. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure DNET tumoroid growth in the presence of HH pathway inhibitors. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates using one mouse DNET tumoroid line). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. D Relative BrdU incorporation in a second GFAP ΔMen1 DNET tumoroid line and ( E ) a jejunal tumoroid line (J-NET) after 72 h treatment. ( n = 4). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F Western blot analysis of SHH, ERK, and AKT growth pathways in J-NET tumoroids after 72 h treatment. G Western blot quantitation of SHH and ( H ) phosphorylated and total ERK and AKT proteins normalized to GAPDH and DMSO vehicle control. ( n = 3). * = p < 0.05 by Kruskal-Wallis test. I Crystal violet staining of mouse STC-1 SI-NET cells after 48 h treatment with agonists and inhibitors of the HH signaling pathway. J BrdU incorporation in STC-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test

Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP), SAG (Tocris, Cat# 4366), vismodegib (Tocris, Cat# 7710), sonidegib (Tocris, Cat# 7826), GANT61 (Tocris, Cat# 3191), and itraconazole (Tocris, Cat# 5981).

Techniques: Activation Assay, Inhibition, Fluorescence, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Staining

Relative expression of target peptides in  cisplatin‐resistant/sensitive  serum of ovarian cancer.

Journal: Journal of Cell Communication and Signaling

Article Title: The small molecule peptide ANXA114‐26 inhibits ovarian cancer cell proliferation and reverses cisplatin resistance by binding to the formyl peptide receptors receptor

doi: 10.1002/ccs3.12058

Figure Lengend Snippet: Relative expression of target peptides in cisplatin‐resistant/sensitive serum of ovarian cancer.

Article Snippet: Cisplatin, Ac2‐26 and Boc‐MLF were purchased from Glpbio (Glpbio, Inc., California, USA). β‐actin,Bax,Bcl‐2,MRP1, Cyclin D1, ANXA1 and NF‐ĸBp65 antibodies were purchased from Wanleibio (Wanleibio, China).

Techniques: Expressing, Sequencing

The combination of ANXA114‐26 and cisplatin inhibits the proliferation of ovarian cancer cells and reduces the expression of drug‐resistant proteins. (A) Changes in cell viability in SKOV3 cell lines. (B) Changes in cell viability in SKOV3/DDP cell lines. (C) The cell proliferation rate of SKOV3 cell line was detected by EdU. (D) The cell proliferation rate of SKOV3/DDP cell line was detected by EdU. (E) The relative expression of BAX mRNA. (F) The relative expression of Bcl‐2 mRNA. (G) Protein expression levels of BAX and Bcl‐2. (H) The relative expression of MRP1 mRNA. (I) Protein expression levels of MRP1. The data are represented as the mean ± SD. The data were independently replicated in triplicate., * p < 0.05, ** p < 0.01. Compared to 10 μg/mlANXA114‐26+ DDP, # p < 0.05, ## p < 0.01.

Journal: Journal of Cell Communication and Signaling

Article Title: The small molecule peptide ANXA114‐26 inhibits ovarian cancer cell proliferation and reverses cisplatin resistance by binding to the formyl peptide receptors receptor

doi: 10.1002/ccs3.12058

Figure Lengend Snippet: The combination of ANXA114‐26 and cisplatin inhibits the proliferation of ovarian cancer cells and reduces the expression of drug‐resistant proteins. (A) Changes in cell viability in SKOV3 cell lines. (B) Changes in cell viability in SKOV3/DDP cell lines. (C) The cell proliferation rate of SKOV3 cell line was detected by EdU. (D) The cell proliferation rate of SKOV3/DDP cell line was detected by EdU. (E) The relative expression of BAX mRNA. (F) The relative expression of Bcl‐2 mRNA. (G) Protein expression levels of BAX and Bcl‐2. (H) The relative expression of MRP1 mRNA. (I) Protein expression levels of MRP1. The data are represented as the mean ± SD. The data were independently replicated in triplicate., * p < 0.05, ** p < 0.01. Compared to 10 μg/mlANXA114‐26+ DDP, # p < 0.05, ## p < 0.01.

Article Snippet: Cisplatin, Ac2‐26 and Boc‐MLF were purchased from Glpbio (Glpbio, Inc., California, USA). β‐actin,Bax,Bcl‐2,MRP1, Cyclin D1, ANXA1 and NF‐ĸBp65 antibodies were purchased from Wanleibio (Wanleibio, China).

Techniques: Expressing

Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD +  Ac2-26,  HFD, and HFD + Ac2-26 groups

Journal: Cardiovascular Diabetology

Article Title: ANXA1-FPR2 axis mitigates the susceptibility to atrial fibrillation in obesity via rescuing AMPK activity in response to lipid overload

doi: 10.1186/s12933-024-02545-z

Figure Lengend Snippet: Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + Ac2-26, HFD, and HFD + Ac2-26 groups

Article Snippet: The mice were intraperitoneally injected with Ac2-26 (1 mg/kg; Topscience, Shanghai, China), an ANXA1 mimetic peptide, or vehicle for a duration of 10 weeks [ ].

Techniques: