|
Tocris
peptide ac2 26 Peptide Ac2 26, supplied by Tocris, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc03288723-46-0-3?v=Tocris Average 94 stars, based on 1 article reviews
peptide ac2 26 - by Bioz Stars,
2026-08
94/100 stars
|
Buy from Supplier |
|
Tocris
sag ![]() Sag, supplied by Tocris, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc13032639-139-16-17?v=Tocris Average 93 stars, based on 1 article reviews
sag - by Bioz Stars,
2026-08
93/100 stars
|
Buy from Supplier |
|
BOC Sciences
ac2 26 ![]() Ac2 26, supplied by BOC Sciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pm20079938-10-14-35?v=BOC+Sciences Average 90 stars, based on 1 article reviews
ac2 26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Bankpeptide biological technology co LTD
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk ![]() Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk, supplied by Bankpeptide biological technology co LTD, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/ppr0164584-54-2-7?v=Bankpeptide+biological+technology+co+LTD Average 90 stars, based on 1 article reviews
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GlpBio Technology Inc
ac2-26 ![]() Ac2 26, supplied by GlpBio Technology Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc11659116-61-0-7?v=GlpBio+Technology+Inc Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Biopeptide
peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk) ![]() Peptides And Antibodies Murine Ac2 26 (Acetyl Amvseflkqarflenqeqeyvqavk), supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc03464519-45-9-19?v=Biopeptide Average 90 stars, based on 1 article reviews
peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk) - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GenScript corporation
ac2 26 ![]() Ac2 26, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc07160667-192-2-8?v=GenScript+corporation Average 90 stars, based on 1 article reviews
ac2 26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Topscience Co Ltd
ac2-26 ![]() Ac2 26, supplied by Topscience Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc11662704-86-6-9?v=Topscience+Co+Ltd Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
ChinaPeptides
cy5-labeled ac2-26 ![]() Cy5 Labeled Ac2 26, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc06755521__ADVS___6___1900610___s001-6-5-15?v=ChinaPeptides Average 90 stars, based on 1 article reviews
cy5-labeled ac2-26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GenicBio BioTech Co Ltd
ac2-26 ![]() Ac2 26, supplied by GenicBio BioTech Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/ppr0133238-51-27-34?v=GenicBio+BioTech+Co+Ltd Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GL Biochem
1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) ![]() 1μm Annexin A1 N Terminal Derived Peptide Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk), supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/ppr0522296-65-21-24?v=GL+Biochem Average 90 stars, based on 1 article reviews
1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Pepceuticals Ltd
ac2-26 peptide ![]() Ac2 26 Peptide, supplied by Pepceuticals Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/ac2+26/pmc09182642-73-10-16?v=Pepceuticals+Ltd Average 90 stars, based on 1 article reviews
ac2-26 peptide - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed to recombinant human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Derivative Assay, Activation Assay, Inhibition, Fluorescence, Staining, Recombinant, Expressing, Quantitative RT-PCR, Control, Labeling, Quantitation Assay, BrdU Incorporation Assay
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: HH signaling regulates the growth of GFAP ΔMen1 and Sox10 ΔMen1 pancreatic NET tumoroids. A Phase contrast and ( B ) fluorescence images of PanNET tumoroids from Sox10-Cre; Men1 FL/FL ; LSL-tdTomato mice. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure PanNET tumoroid growth in the presence of HH pathway agonists or ( D ) inhibitors of the canonical and ( E ) non-canonical HH signaling pathways. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates in two unique mouse PanNET tumoroid lines). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F BrdU incorporation was used to measure tumoroid proliferation in GFAP ΔMen1 and Sox10 ΔMen1 PanNET tumoroids after 72 h treatment. ( n = 4). ** = p < 0.01, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. G Relative fold-change in Chga mRNA levels in PanNET tumoroids following 72 h treatment. ( n = 5). H Western blot analysis of HH pathway proteins in PanNET tumoroids after 72 h treatment. I Quantitation of SHH protein expression normalized to beta-actin and DMSO vehicle control from the western blot analysis in panel ( H ). ( n = 3). J Western blot analysis and ( K ) associated quantitation of phosphorylated and total ERK and AKT growth pathways in PanNET tumoroids after 72 h treatment. ( n = 3). * = p < 0.05, ** = p < 0.01, *** = p < 0.001 by Kruskal-Wallis test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Fluorescence, Protein-Protein interactions, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Expressing
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: GFAP ΔMen1 DNETs and jejunal NETs are sensitive to HH pathway activation and inhibition. A Phase contrast and ( B ) fluorescence images of DNET tumoroids from a GFAP-Cre; Men1 FL/FL ; LSL-tdTomato mouse. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure DNET tumoroid growth in the presence of HH pathway inhibitors. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates using one mouse DNET tumoroid line). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. D Relative BrdU incorporation in a second GFAP ΔMen1 DNET tumoroid line and ( E ) a jejunal tumoroid line (J-NET) after 72 h treatment. ( n = 4). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F Western blot analysis of SHH, ERK, and AKT growth pathways in J-NET tumoroids after 72 h treatment. G Western blot quantitation of SHH and ( H ) phosphorylated and total ERK and AKT proteins normalized to GAPDH and DMSO vehicle control. ( n = 3). * = p < 0.05 by Kruskal-Wallis test. I Crystal violet staining of mouse STC-1 SI-NET cells after 48 h treatment with agonists and inhibitors of the HH signaling pathway. J BrdU incorporation in STC-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Activation Assay, Inhibition, Fluorescence, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Staining
Journal: Journal of Cell Communication and Signaling
Article Title: The small molecule peptide ANXA114‐26 inhibits ovarian cancer cell proliferation and reverses cisplatin resistance by binding to the formyl peptide receptors receptor
doi: 10.1002/ccs3.12058
Figure Lengend Snippet: Relative expression of target peptides in cisplatin‐resistant/sensitive serum of ovarian cancer.
Article Snippet:
Techniques: Expressing, Sequencing
Journal: Journal of Cell Communication and Signaling
Article Title: The small molecule peptide ANXA114‐26 inhibits ovarian cancer cell proliferation and reverses cisplatin resistance by binding to the formyl peptide receptors receptor
doi: 10.1002/ccs3.12058
Figure Lengend Snippet: The combination of ANXA114‐26 and cisplatin inhibits the proliferation of ovarian cancer cells and reduces the expression of drug‐resistant proteins. (A) Changes in cell viability in SKOV3 cell lines. (B) Changes in cell viability in SKOV3/DDP cell lines. (C) The cell proliferation rate of SKOV3 cell line was detected by EdU. (D) The cell proliferation rate of SKOV3/DDP cell line was detected by EdU. (E) The relative expression of BAX mRNA. (F) The relative expression of Bcl‐2 mRNA. (G) Protein expression levels of BAX and Bcl‐2. (H) The relative expression of MRP1 mRNA. (I) Protein expression levels of MRP1. The data are represented as the mean ± SD. The data were independently replicated in triplicate., * p < 0.05, ** p < 0.01. Compared to 10 μg/mlANXA114‐26+ DDP, # p < 0.05, ## p < 0.01.
Article Snippet:
Techniques: Expressing
Journal: Cardiovascular Diabetology
Article Title: ANXA1-FPR2 axis mitigates the susceptibility to atrial fibrillation in obesity via rescuing AMPK activity in response to lipid overload
doi: 10.1186/s12933-024-02545-z
Figure Lengend Snippet: Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + Ac2-26, HFD, and HFD + Ac2-26 groups
Article Snippet: The mice were intraperitoneally injected with
Techniques: